PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.7867s1139.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family HD-ZIP
Protein Properties Length: 833aa    MW: 91937.2 Da    PI: 6.3136
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.7867s1139.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.89.2e-191573357
                         --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
             Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                         k  ++t+eq+e+Le+l++ +++ps  +r++L +++    +++ +q+kvWFqNrR +ek+
  Bostr.7867s1139.1.p 15 KYVRYTPEQVEALERLYNDCPKPSSMRRQQLIRECpilsNIEPKQIKVWFQNRRCREKQ 73
                         5679*****************************************************97 PP

2START1947e-611593672205
                          HHHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS.SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-SEEEEEEEECTT..E CS
                START   2 laeeaaqelvkkalaeepgWvkssesengdevlqkfeeskvdsgealrasgvvdmvlallveellddkeqWdetlakaetlevissg..g 89 
                          +a e+++e+++ka+ ++  Wv+++ +++g++++ +++ s++++g a+ra+g+v  +++  v+e+l+dk++W +++++ ++++v+s++  g
  Bostr.7867s1139.1.p 159 IADETLTEFISKATGTAVEWVQMPGMKPGPDSYGIVAISHGCTGIAARACGLVGLDPT-RVAEILKDKPCWLRDCRSLDIVNVLSTAngG 247
                          68899*****************************************************.9999****99*****************999* PP

                          EEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--....-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SS CS
                START  90 alqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe...sssvvRaellpSgiliepksnghskvtwvehvdlkgr 175
                          +l+l++++l+a+++l+p Rdf+++Ry+  +++g++vi+++S++++q+ p+   s+++vRae lpSg+li+p+++g+s +++v+h+dl+ +
  Bostr.7867s1139.1.p 248 TLELIYMQLYAPTTLAPaRDFWMLRYTSVMEDGSLVICERSLNNTQNGPSmppSPHFVRAEILPSGYLIRPCEGGGSILHIVDHFDLEPW 337
                          ************************************************99999************************************* PP

                          XXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
                START 176 lphwllrslvksglaegaktwvatlqrqce 205
                          +++++lrsl++s++  +++t++a+l+++++
  Bostr.7867s1139.1.p 338 SVPEVLRSLYESSTLLAQRTTMAALRYLRQ 367
                          *************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007115.4991074IPR001356Homeobox domain
SMARTSM003891.7E-151278IPR001356Homeobox domain
SuperFamilySSF466891.71E-161578IPR009057Homeodomain-like
CDDcd000861.19E-161575No hitNo description
PfamPF000462.7E-161673IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.5E-181773IPR009057Homeodomain-like
CDDcd146861.13E-667106No hitNo description
PROSITE profilePS5084826.809149377IPR002913START domain
CDDcd088752.32E-82153368No hitNo description
Gene3DG3DSA:3.30.530.206.0E-24157363IPR023393START-like domain
SuperFamilySSF559613.43E-36158369No hitNo description
SMARTSM002341.6E-42158368IPR002913START domain
PfamPF018522.3E-58159367IPR002913START domain
PfamPF086704.5E-48690831IPR013978MEKHLA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009733Biological Processresponse to auxin
GO:0010067Biological Processprocambium histogenesis
GO:0010072Biological Processprimary shoot apical meristem specification
GO:0010089Biological Processxylem development
GO:0045597Biological Processpositive regulation of cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 833 aa     Download sequence    Send to blast
MGGGSNNSHN IDNGKYVRYT PEQVEALERL YNDCPKPSSM RRQQLIRECP ILSNIEPKQI  60
KVWFQNRRCR EKQRKEASRL QAVNRKLTAM NKLLMEENDR LQKQVSHLVY ENSYFRQHPQ  120
NGNLATTDTS CESVVTSGQH HLTPQHQPRD ASPAGLLSIA DETLTEFISK ATGTAVEWVQ  180
MPGMKPGPDS YGIVAISHGC TGIAARACGL VGLDPTRVAE ILKDKPCWLR DCRSLDIVNV  240
LSTANGGTLE LIYMQLYAPT TLAPARDFWM LRYTSVMEDG SLVICERSLN NTQNGPSMPP  300
SPHFVRAEIL PSGYLIRPCE GGGSILHIVD HFDLEPWSVP EVLRSLYESS TLLAQRTTMA  360
ALRYLRQISQ EISQPNVTGW GRRPAALRAL SQRLSKGFNE AVNGFSDEGW SILESDGIDD  420
VTLLVNTSPT KMMMTSSLPF ANGFTSMPSA VLCAKASMLL QNVPPSILLR FLREHRQEWA  480
DNSIDAYSAA AIKAGPCSLP IPRPGSFGGQ VILPLAHTIE NEEFMEVIKL ESLGHYQEDM  540
MMPADIFLLQ MCSGVDENAV ESCAELIFAP IDASFSDDAP IIPSGFRIIP LDSKSEGLSP  600
NRTLDLASAL DVGSRTAGDS CGSRGNTKSV MTIAFQLAFE MHMQDNVASM ARQYVRSVIA  660
SVQRVALALS PSSHQLSGLR PPPASPEAHT LARWISHSYR CYLGVDLLKP HGTDLLKSLW  720
HHPDAVMCCS LKALPPVFTF ANQAGLDMLE TTLVALQDIT LEKIFDNNNG KKTLCSEFPQ  780
IMQQGFMCMD GGVCMSSMGR AVTYEKAVAW KVLNDNEDPH CICFMFLNWS FI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4412920.0AJ441292.1 Arabidopsis thaliana mRNA for homeodomain-leucine zipper protein 8 (hb-8 gene).
GenBankAY0996310.0AY099631.1 Arabidopsis thaliana HD-zip transcription factor (athb-8) (At4g32880) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010432644.10.0PREDICTED: homeobox-leucine zipper protein ATHB-8 isoform X2
SwissprotQ391230.0ATHB8_ARATH; Homeobox-leucine zipper protein ATHB-8
TrEMBLR0F3010.0R0F301_9BRAS; Uncharacterized protein
STRINGAT4G32880.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20222678
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32880.10.0homeobox gene 8